PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29910.m000940
Common NameLOC8282472, RCOM_1044250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 594aa    MW: 67317.4 Da    PI: 4.8576
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29910.m000940genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.19.9e-952125822374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaal...kl..fsevsPil 91 
                     e Ll+ Ae + +++   a++lL++   ++s++g+p+qR++ yf+eAL+ r+   ++++ +k l  +++ e   ++e++++   ++   +  +P+ 
  29910.m000940 212 AESLLASAERIGNQQYDSASRLLKQCDSISSNTGNPVQRVVYYFAEALHDRIDIeTGKTKSKELGKKQAFE---IDEAMMTpnpTIlaSHLETPFC 304
                    57899***********************************************9845555566665555443...3333333222333223349*** PP

           GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                    +++h++  qaI++ v+ ++++Hi+D+++ +G+QW  L+qaL sR   +  +l+iT++g    +s+e +e+tg+rL +fAe++++ f+f++ ++++l
  29910.m000940 305 QVAHFAGIQAIVDNVADAKKIHILDLSLRYGMQWTVLMQALVSRCdCPLEHLKITAIGT---TSRELIENTGKRLISFAETMNIAFSFKMALVSDL 397
                    ********************************************945556*********...6899************************99**** PP

           GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     dl+ + L+++ gE++a+ +++   +l     sl+++ d++++++k+++P v+vv+e ea+hns++F++rf+eal yysa fd+l+a + r++++r
  29910.m000940 398 LDLKEDLLDLDDGETVAIYFAYLPRNLI----SLPNRLDSMMRMIKNVNPCVIVVAEVEANHNSPTFVNRFVEALFYYSAYFDCLDACMERNDKNR 489
                    *********************9666665....9999999********************************************************* PP

           GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    + +E +++g  i+n++a+eg+er+ r+ +l  Wr+ + ++G+ +  ls++a  qa+l+++k++ ++ ++++ + +slvlgWk+ pL s+SaW+
  29910.m000940 490 MIMESMYFGIGIKNMIATEGEERVIRNVKLDAWRAFFARFGMVETDLSSSALLQANLIVKKFAcGNCFTLDRNGKSLVLGWKGTPLHSLSAWK 582
                    ***************************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.815185561IPR005202Transcription factor GRAS
PfamPF035143.4E-92212582IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MANEKFPAEQ FNGYGFEDNF SFTNKSMDEG NTRTQSSFYG VEEWGESSDN GLYQNNQWEE  60
ELLMSKYDQQ DQQQNSFGDY MHLDDLRFGI LSPPLQKCYQ EITQLDEIQS GIREVKSKKE  120
NPYAFPLASL ELLKSHTNGF NQLNSMRMLE PNKFDSSIKV VGQELSTEDI MRIAGARFLQ  180
SSCHDVASMF NNPFDLYFSG LSDEDAKHVE LAESLLASAE RIGNQQYDSA SRLLKQCDSI  240
SSNTGNPVQR VVYYFAEALH DRIDIETGKT KSKELGKKQA FEIDEAMMTP NPTILASHLE  300
TPFCQVAHFA GIQAIVDNVA DAKKIHILDL SLRYGMQWTV LMQALVSRCD CPLEHLKITA  360
IGTTSRELIE NTGKRLISFA ETMNIAFSFK MALVSDLLDL KEDLLDLDDG ETVAIYFAYL  420
PRNLISLPNR LDSMMRMIKN VNPCVIVVAE VEANHNSPTF VNRFVEALFY YSAYFDCLDA  480
CMERNDKNRM IMESMYFGIG IKNMIATEGE ERVIRNVKLD AWRAFFARFG MVETDLSSSA  540
LLQANLIVKK FACGNCFTLD RNGKSLVLGW KGTPLHSLSA WKFISHEKKG VNSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-392165828375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002523464.10.0PREDICTED: DELLA protein RGL1
TrEMBLB9SBU50.0B9SBU5_RICCO; DELLA protein GAI1, putative
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-56RGA-like 2